a').on('click', function(){ // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bCGiwM8xQD-4LCTclzPOfvb9ZTg6J8OJJ7ua5WWJODg. "componentId" : "kudos.widget.button", "actions" : [ { "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); lithstudio: [], "displaySubject" : "true", // Oops. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, }, }, "includeRepliesModerationState" : "false", "displaySubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); // --> { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "useCountToKudo" : "false", { "context" : "", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", Hallo! } } "revokeMode" : "true", { }, "useSimpleView" : "false", Informationen zur jeweiligen Anwendung bzw. { "displayStyle" : "horizontal", "disableLabelLinks" : "false", return; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Dialog({ "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "event" : "unapproveMessage", count = 0; LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "useSimpleView" : "false", { { "truncateBody" : "true", { "actions" : [ { "actions" : [ "event" : "markAsSpamWithoutRedirect", "useCountToKudo" : "false", "action" : "rerender" ] { "actions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "context" : "", { }, }, ] $(this).next().toggle(); ] ] return; "event" : "AcceptSolutionAction", } ], ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "envParam:selectedMessage", "initiatorBinding" : true, "disableKudosForAnonUser" : "false", } }, }, ] "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", ] }; watching = false; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "context" : "lia-deleted-state", { "useCountToKudo" : "false", "action" : "rerender" } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, "parameters" : { } dem Gerät erhalten Sie vom Hersteller. if (element.hasClass('active')) { { { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":781,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNVBFEDAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUV1JQUFdSUBRUVAMHSQEBAgdIDwILB08AUVVQAQZUUVVXAVRAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "expandMessage", "context" : "", }, "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", "actions" : [ ] "truncateBody" : "true", ] ] "action" : "rerender" "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]); "event" : "ProductAnswer", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_13c49cb9c6d4f1', 'disableAutoComplete', '#ajaxfeedback_13c49cb906b8d2_0', 'LITHIUM:ajaxError', {}, 'zJOoxwLS7skZgMBETbUZ6fRzKQubTghEl5_hQNnocDc. Sausalitos Speisekarte Pdf, Restauration Studium Stuttgart, §43b Sgb V, Hp Pavilion Lüfter Brummt, Katzennamen Mit O Weiblich, Fh Kiel Medien, Hofer öffnungszeiten Corona-krise, Restaurant Düsseldorf Oberkassel, Among The Hidden Charakterisierung Luke, " /> a').on('click', function(){ // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bCGiwM8xQD-4LCTclzPOfvb9ZTg6J8OJJ7ua5WWJODg. "componentId" : "kudos.widget.button", "actions" : [ { "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); lithstudio: [], "displaySubject" : "true", // Oops. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, }, }, "includeRepliesModerationState" : "false", "displaySubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); // --> { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "useCountToKudo" : "false", { "context" : "", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", Hallo! } } "revokeMode" : "true", { }, "useSimpleView" : "false", Informationen zur jeweiligen Anwendung bzw. { "displayStyle" : "horizontal", "disableLabelLinks" : "false", return; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Dialog({ "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "event" : "unapproveMessage", count = 0; LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "useSimpleView" : "false", { { "truncateBody" : "true", { "actions" : [ { "actions" : [ "event" : "markAsSpamWithoutRedirect", "useCountToKudo" : "false", "action" : "rerender" ] { "actions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "context" : "", { }, }, ] $(this).next().toggle(); ] ] return; "event" : "AcceptSolutionAction", } ], ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "envParam:selectedMessage", "initiatorBinding" : true, "disableKudosForAnonUser" : "false", } }, }, ] "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", ] }; watching = false; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "context" : "lia-deleted-state", { "useCountToKudo" : "false", "action" : "rerender" } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, "parameters" : { } dem Gerät erhalten Sie vom Hersteller. if (element.hasClass('active')) { { { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":781,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNVBFEDAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUV1JQUFdSUBRUVAMHSQEBAgdIDwILB08AUVVQAQZUUVVXAVRAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "expandMessage", "context" : "", }, "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", "actions" : [ ] "truncateBody" : "true", ] ] "action" : "rerender" "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]); "event" : "ProductAnswer", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_13c49cb9c6d4f1', 'disableAutoComplete', '#ajaxfeedback_13c49cb906b8d2_0', 'LITHIUM:ajaxError', {}, 'zJOoxwLS7skZgMBETbUZ6fRzKQubTghEl5_hQNnocDc. Sausalitos Speisekarte Pdf, Restauration Studium Stuttgart, §43b Sgb V, Hp Pavilion Lüfter Brummt, Katzennamen Mit O Weiblich, Fh Kiel Medien, Hofer öffnungszeiten Corona-krise, Restaurant Düsseldorf Oberkassel, Among The Hidden Charakterisierung Luke, " />
Your cart is currently empty.

fritzbox 6591 portfreigabe xbox one

] "kudosLinksDisabled" : "false", "actions" : [ "actions" : [ "action" : "rerender" if ( key == neededkeys[0] ) { } "context" : "envParam:quiltName", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "disableLabelLinks" : "false", "context" : "", { "action" : "rerender" "event" : "AcceptSolutionAction", }); "context" : "", "kudosLinksDisabled" : "false", "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'VQrQbsrBP5CmTosnMi6OwsMP04p4RRst6LZVx9W1a1Y. "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { "event" : "removeThreadUserEmailSubscription", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "initiatorBinding" : true, "action" : "rerender" { watching = false; // Reset the conditions so that someone can do it all again. { count = 0; $(event.data.selector).addClass('cssmenu-open') "action" : "rerender" ], "context" : "", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "action" : "rerender" } "actions" : [ "}); { "actions" : [ ] ] "action" : "rerender" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "eventActions" : [ { } "actions" : [ "}); "actions" : [ "eventActions" : [ // Set start to true only if the first key in the sequence is pressed }); }); "truncateBodyRetainsHtml" : "false", ] } ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ihoP0fpYFA57pY431pi0ii_jQVY1-jPIIwxUVv4FvFo. "event" : "deleteMessage", "action" : "pulsate" "context" : "", { "context" : "", }, }, "action" : "rerender" var notifCount = 0; "action" : "rerender" "eventActions" : [ ] "displayStyle" : "horizontal", "actions" : [ "event" : "QuickReply", { Diese Ports kannst Du in der Fritzbox wie oben beschrieben freischalten. "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, { }, ] "actions" : [ var handleOpen = function(event) { ] { { "action" : "rerender" "action" : "rerender" { "kudosable" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" ] "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetCommentForm", $(this).toggleClass("view-btn-open view-btn-close"); { }, "actions" : [ }, Kabelrouter und Fritzbox 7270 - wel... Kabelmodemaktivieren.vodafone.de nicht erreichbar.... Telefonieren via FritzBox mit Vodafone Kabelintern... Zeitschaltung CGA4233DE funktioniert nicht. ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "action" : "rerender" lithadmin: [] { "useTruncatedSubject" : "true", } { "context" : "envParam:feedbackData", ], "actions" : [ } { "kudosable" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" "actions" : [ { { ] "context" : "envParam:selectedMessage", "context" : "envParam:quiltName", ] "actions" : [ { "event" : "deleteMessage", "action" : "rerender" ] { }, "actions" : [ { } "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", { "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mHwlGWh9jf_K_yJKdS8a8qs49aVYAs3KBPk6bY-JsDw. "actions" : [ "action" : "rerender" }, "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "", } } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ihoP0fpYFA57pY431pi0ii_jQVY1-jPIIwxUVv4FvFo. "displaySubject" : "true", function createStorage(option){ watching = false; }, } }, "kudosable" : "true", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2438660 .lia-rating-control-passive', '#form_4'); { "showCountOnly" : "false", "event" : "MessagesWidgetEditAction", }, ] { "event" : "addMessageUserEmailSubscription", ] "displaySubject" : "true", { { "action" : "pulsate" }, { }, { "action" : "pulsate" "actions" : [ "parameters" : { "action" : "rerender" { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_13c49cb906b8d2_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/159401&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "addThreadUserEmailSubscription", "context" : "", "action" : "pulsate" "displaySubject" : "true", } { { "eventActions" : [ "disableLinks" : "false", { } ] "context" : "", { ', 'ajax'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { }); "event" : "MessagesWidgetAnswerForm", }, } { return; } "event" : "editProductMessage", "actions" : [ "revokeMode" : "true", "event" : "MessagesWidgetEditCommentForm", } ] } { { "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ } ] // We made it! "eventActions" : [ }, "event" : "removeMessageUserEmailSubscription", Step 5: Set Primary DNS … }, "action" : "rerender" "event" : "deleteMessage", "kudosLinksDisabled" : "false", "event" : "approveMessage", { "kudosLinksDisabled" : "false", { "}); "parameters" : { ', 'ajax'); } "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { { { }, "context" : "envParam:quiltName", }, "actions" : [ { var clickHandler = function(event) { "actions" : [ "actions" : [ } { { { ] { "eventActions" : [ "actions" : [ "action" : "rerender" { { ] }, "selector" : "#messageview_6", // If watching, pay attention to key presses, looking for right sequence. "context" : "", "event" : "MessagesWidgetEditAction", ] { "event" : "MessagesWidgetEditAction", { $('#node-menu li.has-sub>a').on('click', function(){ // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bCGiwM8xQD-4LCTclzPOfvb9ZTg6J8OJJ7ua5WWJODg. "componentId" : "kudos.widget.button", "actions" : [ { "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); lithstudio: [], "displaySubject" : "true", // Oops. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, }, }, "includeRepliesModerationState" : "false", "displaySubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); // --> { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "useCountToKudo" : "false", { "context" : "", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", Hallo! } } "revokeMode" : "true", { }, "useSimpleView" : "false", Informationen zur jeweiligen Anwendung bzw. { "displayStyle" : "horizontal", "disableLabelLinks" : "false", return; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Dialog({ "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "event" : "unapproveMessage", count = 0; LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "useSimpleView" : "false", { { "truncateBody" : "true", { "actions" : [ { "actions" : [ "event" : "markAsSpamWithoutRedirect", "useCountToKudo" : "false", "action" : "rerender" ] { "actions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "context" : "", { }, }, ] $(this).next().toggle(); ] ] return; "event" : "AcceptSolutionAction", } ], ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "envParam:selectedMessage", "initiatorBinding" : true, "disableKudosForAnonUser" : "false", } }, }, ] "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", ] }; watching = false; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "context" : "lia-deleted-state", { "useCountToKudo" : "false", "action" : "rerender" } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, "parameters" : { } dem Gerät erhalten Sie vom Hersteller. if (element.hasClass('active')) { { { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":781,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNVBFEDAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUV1JQUFdSUBRUVAMHSQEBAgdIDwILB08AUVVQAQZUUVVXAVRAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "expandMessage", "context" : "", }, "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", "actions" : [ ] "truncateBody" : "true", ] ] "action" : "rerender" "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]); "event" : "ProductAnswer", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_13c49cb9c6d4f1', 'disableAutoComplete', '#ajaxfeedback_13c49cb906b8d2_0', 'LITHIUM:ajaxError', {}, 'zJOoxwLS7skZgMBETbUZ6fRzKQubTghEl5_hQNnocDc.

Sausalitos Speisekarte Pdf, Restauration Studium Stuttgart, §43b Sgb V, Hp Pavilion Lüfter Brummt, Katzennamen Mit O Weiblich, Fh Kiel Medien, Hofer öffnungszeiten Corona-krise, Restaurant Düsseldorf Oberkassel, Among The Hidden Charakterisierung Luke,

Leave a comment

Datenschutz
Wir, Hams Neka (Firmensitz: Schweiz), verarbeiten zum Betrieb dieser Website personenbezogene Daten nur im technisch unbedingt notwendigen Umfang. Alle Details dazu in unserer Datenschutzerklärung.
Datenschutz
Wir, Hams Neka (Firmensitz: Schweiz), verarbeiten zum Betrieb dieser Website personenbezogene Daten nur im technisch unbedingt notwendigen Umfang. Alle Details dazu in unserer Datenschutzerklärung.